Farting Tube

I feel lucky

Categories

All Categories

Boss Humiliates You With Her Farts

Thankyou for your vote!
96%
Rates : 2882
I like this video Good I dont like this video Bad
29407  Views
Video Tags:
bubblyfacefartfartingfartsgirlgirlshotlongloudmouthpovsexyslavesmellingsmellysniffersniffingwet
Categories:
BritishBrunetteExclusiveFetishVerified Models


Video Suggestions

Alzena & Divine Face Ass Blast Double Team
Play Icon
76%45179  ViewsAlzena & Divine Face Ass Blast Double Team
Enormous Fart
Play Icon
87%24978  ViewsEnormous Fart
Filthy Feet And Farts In Your Face
Play Icon
80%25186  ViewsFilthy Feet And Farts In Your Face
Kat Farting 02
Play Icon
77%23341  ViewsKat Farting 02
Powerful Ebony Farts
Play Icon
93%29863  ViewsPowerful Ebony Farts
Obese Wrestles And Pins Down And Farts On Hapless Male
Play Icon
95%49922  ViewsObese Wrestles And Pins Down And Farts On Hapless Male
Black Giantess Farting On Little
Play Icon
84%33211  ViewsBlack Giantess Farting On Little
Ebony Farting (Custom Video)
Play Icon
83%37000  ViewsEbony Farting (Custom Video)
Piss Fetish Barbie Gets A Protein Boost
Play Icon
94%20008  ViewsPiss Fetish Barbie Gets A Protein Boost
Farting
Play Icon
76%36788  ViewsFarting
Kitchen Spandex Fart
Play Icon
85%46577  ViewsKitchen Spandex Fart
As Your Girlfriend Want To Share Farts With You., All Of My Farts Catch To Jar
Play Icon
97%43827  ViewsAs Your Girlfriend Want To Share Farts With You., All Of My Farts Catch To Jar
Smelling Asshole And Bubbly Farts Through Leggings
Play Icon
85%21963  ViewsSmelling Asshole And Bubbly Farts Through Leggings
Whipped Cream Anal Fisting And Farting Whipped Cream
Play Icon
81%39613  ViewsWhipped Cream Anal Fisting And Farting Whipped Cream
Stink_fart_assault_2
Play Icon
87%45363  ViewsStink_fart_assault_2
Adult Wordpress Themes

ADVERTISEMENT

Categories
Popular Tags